PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G010200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 489aa    MW: 53231.1 Da    PI: 8.7623
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G010200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1331e-41192269178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +CqvegC+ dls+ak+yhr+h+vCe hsk+p+v+v+g+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk+q+
  Manes.12G010200.1.p 192 RCQVEGCNLDLSSAKDYHRKHRVCESHSKSPKVTVAGVERRFCQQCSRFHGLSEFDEKKRSCRRRLSDHNARRRKPQP 269
                          6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-34185254IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.094190267IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-39191272IPR004333Transcription factor, SBP-box
PfamPF031106.1E-32193266IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MSSFSLMEWN TKPPIQWDWE NLIMFNATTE HPKKLRLTEW ETDGERGIDS GSLYSSASGG  60
SGSGSGSGSG SDLGLASLSK SSKSASINSS SIGEVKTSKF TLEASEAIPE DSNNKKVLAK  120
AKQTGISSTL EASVGSGEPL LGLKLGKRTY FEDVCAGSNA KTSPFSVTPS PGTSVSPAKR  180
SKSSGQASPA PRCQVEGCNL DLSSAKDYHR KHRVCESHSK SPKVTVAGVE RRFCQQCSRF  240
HGLSEFDEKK RSCRRRLSDH NARRRKPQPE SVQLTPARLS SSLYDERQQM SLVWNRAPLV  300
YSRPDANLTW EGTSSSKFTI TKEYVPKAAK GGGIDGQLHL PGNDLTTSIP MHPHHSKCLL  360
PSKSKVATAE VLNQGLEESI LSPNVDATQD LHRALSLLST NSWGSCEQKS ISHEQPAHTS  420
QAGMPQSLLH NVSQGMPLAS SDYWRAEQQS TDSRVHSLTT HNHNSNYFQE LQQLRTPYDS  480
DFFSSQLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271932661184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248265KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085695.10.0PREDICTED: squamosa promoter-binding-like protein 2
TrEMBLB9RMD60.0B9RMD6_RICCO; LIGULELESS1 protein, putative
STRINGPOPTR_0003s17120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-86squamosa promoter binding protein-like 2